Provider:
www-genesilico-pl
Location:
Warsaw, Poland
Submitter / Source:
jerzyo (2 months ago)
Endpoint:
http://www.genesilico.pl/soap/MetaServer/service/
WSDL Location:
http://www.genesilico.pl/soap/MetaServer/service.wsdl
Documentation URL(s): jerzyo (2 months ago)https://genesilico.pl/meta2
Login to add a documentation URL Description(s): jerzyo (2 months ago)Geneslico SOAP service for protein sequence analysis, which involve
– secondary structure prediction
– domain prediction
– disorder prediction
– dna and rna binding sites prediction
– transmembrane helices prediction
Exposed operations are part of Genesilico metaserver ( https://genesilico.pl/meta2 ).
All operations take protein sequence as input in raw text or fasta format such as:
MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH
and return results in rax text format
ATTENTION: Due to programatic limitations all services embed inputs and outputs in a complex type. This should be represented as XML splitters in Taverna. Both primary and complex types are given as examples
Login to add a description License(s): None Login to add license info Cost: No info yet Login to add cost info Usage Conditions: No info yet Login to add usage conditions info Contact Info: None Login to add contact info Publications: for this service. This can be a URI to the publication and/or a DOI. jerzyo (2 months ago)Kurowski MA, Bujnicki JM
GeneSilico protein structure prediction meta-server
Nucleic Acids Res 2003 Jul 1;31(13):3305-7.
ftp://ftp.genesilico.pl/iamb/papers/2003.NAR.GeneSilico.pdf
Login to add publication info Citations: None Login to add a citation